PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca50873.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 150aa    MW: 17359.1 Da    PI: 9.99
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca50873.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.13e-52121361129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgel 99 
                 lppGfrFhPtd+elv++yL  k ++++ +l   + evd++k+ePwdLp+++  + kewyf+s+rd+kyatg r+nrat sgyWkatgkd++v++ +g+ 
  Dca50873.1  12 LPPGFRFHPTDDELVCDYLLLKWNASHSPL---LIEVDLNKCEPWDLPERACIGGKEWYFYSQRDRKYATGLRTNRATVSGYWKATGKDRAVVR-RGNM 106
                 79***********************99888...779************8777899**************************************9.999* PP

         NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
                 vg++ktLvfy+grapkg+kt+Wvmhe+rle
  Dca50873.1 107 VGMRKTLVFYQGRAPKGHKTQWVMHEFRLE 136
                 ***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.1E-552143IPR003441NAC domain
PROSITE profilePS5100549.44812150IPR003441NAC domain
PfamPF023655.9E-2713135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 150 aa     Download sequence    Send to blast
MMSSLSMVEA KLPPGFRFHP TDDELVCDYL LLKWNASHSP LLIEVDLNKC EPWDLPERAC  60
IGGKEWYFYS QRDRKYATGL RTNRATVSGY WKATGKDRAV VRRGNMVGMR KTLVFYQGRA  120
PKGHKTQWVM HEFRLEPPFV PNNLIPSPSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-5061359140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010666180.14e-86PREDICTED: NAC domain-containing protein 21/22-like isoform X1
RefseqXP_010666181.14e-86PREDICTED: NAC domain-containing protein 21/22-like isoform X2
SwissprotQ84TE61e-77NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A0J8B8I04e-86A0A0J8B8I0_BETVU; Uncharacterized protein
TrEMBLA0A0J8DZI64e-86A0A0J8DZI6_BETVU; Uncharacterized protein
STRINGGLYMA15G40510.11e-79(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.28e-79NAC domain containing protein 1